SCOPe 2.08: Domain d5ilgb_: 5ilg B:

Lineage for d5ilgb_ (5ilg B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [326249] (2 PDB entries)

8. Domain d5ilgb_: 5ilg B: [326266]
   Other proteins in same PDB: d5ilga2
   automated match to d1mg5a_
   complexed with edo, iph, mg, nad

Details for d5ilgb_

PDB Entry: 5ilg, 2.4 Å

PDB Description: crystal structure of photoreceptor dehydrogenase from drosophila melanogaster

PDB Compounds: (B:) Photoreceptor dehydrogenase, isoform C

SCOPe Domain Sequences for d5ilgb_:

Sequence; same for both SEQRES and ATOM records:

>d5ilgb_ c.2.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sfrgknavvtggaggiglqvskqllaagaakvaiidlqdnleefvklraahptqsvmiik
mdvankkgveatyeeiaktfgnidivvnvagifndkdvqrtllvnlggiinstlsalpym
gkdnggkggivvnmssvvgldpmfiipvygatkagiinftrclanekyyqrsgikfvtvc
pgatmtdmftnftekiifpetsdetyrildrlnkqsaadvsrcilnvlekdkngavyvie
gkrvypleikpqwtgkeq

Timeline for d5ilgb_:

• d5ilgb_ first appeared in SCOPe 2.06
  
• d5ilgb_ appears in SCOPe 2.07