SCOPe 2.06: Domain d1b5sa_: 1b5s A:

Lineage for d1b5sa_ (1b5s A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.1: CAT-like [52778] (3 proteins)
   trimeric enzymes with the active sites being located in between subunits

6. Protein Dihydrolipoamide acetyltransferase [52782] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [52784] (1 PDB entry)

8. Domain d1b5sa_: 1b5s A: [32626]

Details for d1b5sa_

PDB Entry: 1b5s, 4.4 Å

PDB Description: dihydrolipoyl transacetylase (e.c.2.3.1.12) catalytic domain (residues 184-425) from bacillus stearothermophilus

PDB Compounds: (A:) dihydrolipoamide acetyltransferase

SCOPe Domain Sequences for d1b5sa_:

Sequence; same for both SEQRES and ATOM records:

>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
aaakpattegefpetrekmsgirraiakamvhskhtaphvtlmdeadvtklvahrkkfka
iaaekgikltflpyvvkalvsalreypvlntsiddeteeiiqkhyynigiaadtdrgllv
pvikhadrkpifalaqeinelaekardgkltpgemkgasctitnigsaggqwftpvinhp
evailgigriaekpivrdgeivaapmlalslsfdhrmidgataqkalnhikrllsdpell
lm

Timeline for d1b5sa_:

• d1b5sa_ first appeared (with stable ids) in SCOP 1.55
  
• d1b5sa_ appears in SCOPe 2.05
  
• d1b5sa_ appears in SCOPe 2.07
  
• d1b5sa_ appears in the current release, SCOPe 2.08