| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.1: Bromodomain [47371] (6 proteins) |
| Protein CREB-binding protein, CBP [74712] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries) |
| Domain d5eicb1: 5eic B:1081-1196 [326256] Other proteins in same PDB: d5eicb2 automated match to d4nyva_ complexed with 5j5, edo |
PDB Entry: 5eic (more details), 1.5 Å
SCOPe Domain Sequences for d5eicb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eicb1 a.29.2.1 (B:1081-1196) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
Timeline for d5eicb1: