Lineage for d1eae__ (1eae -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23950Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
  4. 23951Superfamily c.43.1: CoA-dependent acyltransferases [52777] (1 family) (S)
  5. 23952Family c.43.1.1: CoA-dependent acyltransferases [52778] (3 proteins)
  6. 23963Protein Dihydrolipoamide acetyltransferase [52782] (2 species)
  7. 23964Species Azotobacter vinelandii [TaxId:354] [52783] (9 PDB entries)
  8. 23973Domain d1eae__: 1eae - [32625]

Details for d1eae__

PDB Entry: 1eae (more details), 3 Å

PDB Description: atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex

SCOP Domain Sequences for d1eae__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eae__ c.43.1.1 (-) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii}
ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
avakkagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna
pevailgvskasmqpvwdgkafqprlmlplslsydhrvingaaaarftkrlgdlladira
ill

SCOP Domain Coordinates for d1eae__:

Click to download the PDB-style file with coordinates for d1eae__.
(The format of our PDB-style files is described here.)

Timeline for d1eae__: