Lineage for d5hgrb1 (5hgr B:3-175)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735903Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2735904Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2735937Family a.175.1.0: automated matches [326230] (1 protein)
    not a true family
  6. 2735938Protein automated matches [326231] (3 species)
    not a true protein
  7. 2735939Species Nostoc sp. [TaxId:103690] [326232] (1 PDB entry)
  8. 2735941Domain d5hgrb1: 5hgr B:3-175 [326247]
    Other proteins in same PDB: d5hgra2, d5hgrb2
    automated match to d1m98a1
    complexed with 45d

Details for d5hgrb1

PDB Entry: 5hgr (more details), 1.68 Å

PDB Description: structure of anabaena (nostoc) sp. pcc 7120 orange carotenoid protein binding canthaxanthin
PDB Compounds: (B:) Orange Carotenoid Protein (OCP)

SCOPe Domain Sequences for d5hgrb1:

Sequence, based on SEQRES records: (download)

>d5hgrb1 a.175.1.0 (B:3-175) automated matches {Nostoc sp. [TaxId: 103690]}
itidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaasmq
faegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqgav
apipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakldgytrva

Sequence, based on observed residues (ATOM records): (download)

>d5hgrb1 a.175.1.0 (B:3-175) automated matches {Nostoc sp. [TaxId: 103690]}
itidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaasmq
faegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqgav
apipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakva

SCOPe Domain Coordinates for d5hgrb1:

Click to download the PDB-style file with coordinates for d5hgrb1.
(The format of our PDB-style files is described here.)

Timeline for d5hgrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hgrb2