| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
| Protein automated matches [226997] (13 species) not a true protein |
| Species Amycolatopsis sp. [TaxId:37632] [326207] (5 PDB entries) |
| Domain d5fjpd2: 5fjp D:126-367 [326241] Other proteins in same PDB: d5fjpa1, d5fjpb1, d5fjpc1, d5fjpd1 automated match to d1sjdb1 complexed with mg, npq; mutant |
PDB Entry: 5fjp (more details), 2.58 Å
SCOPe Domain Sequences for d5fjpd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fjpd2 c.1.11.2 (D:126-367) automated matches {Amycolatopsis sp. [TaxId: 37632]}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmgetglgraanval
aslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevttakvw
ig
Timeline for d5fjpd2: