Lineage for d1dpd__ (1dpd -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23950Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
  4. 23951Superfamily c.43.1: CoA-dependent acyltransferases [52777] (1 family) (S)
  5. 23952Family c.43.1.1: CoA-dependent acyltransferases [52778] (3 proteins)
  6. 23963Protein Dihydrolipoamide acetyltransferase [52782] (2 species)
  7. 23964Species Azotobacter vinelandii [TaxId:354] [52783] (9 PDB entries)
  8. 23969Domain d1dpd__: 1dpd - [32624]

Details for d1dpd__

PDB Entry: 1dpd (more details), 2.7 Å

PDB Description: crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)

SCOP Domain Sequences for d1dpd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpd__ c.43.1.1 (-) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii}
ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
avaekagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftiaslghiggtaftpivna
pevailgvskasmqpvwdgkafqprlmlplslsydhrvingaaaarftkrlgdlladira
ill

SCOP Domain Coordinates for d1dpd__:

Click to download the PDB-style file with coordinates for d1dpd__.
(The format of our PDB-style files is described here.)

Timeline for d1dpd__: