Lineage for d5fjpa2 (5fjp A:126-368)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837122Protein automated matches [226997] (13 species)
    not a true protein
  7. 2837143Species Amycolatopsis sp. [TaxId:37632] [326207] (5 PDB entries)
  8. 2837158Domain d5fjpa2: 5fjp A:126-368 [326237]
    Other proteins in same PDB: d5fjpa1, d5fjpb1, d5fjpc1, d5fjpd1
    automated match to d1sjdb1
    complexed with mg, npq; mutant

Details for d5fjpa2

PDB Entry: 5fjp (more details), 2.58 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp ts-1-60: g291d f323y i293g mutant in complex with n-acetyl naphthylalanine
PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjpa2 c.1.11.2 (A:126-368) automated matches {Amycolatopsis sp. [TaxId: 37632]}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmgetglgraanval
aslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevttakvw
igs

SCOPe Domain Coordinates for d5fjpa2:

Click to download the PDB-style file with coordinates for d5fjpa2.
(The format of our PDB-style files is described here.)

Timeline for d5fjpa2: