![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily) multihelical; array |
![]() | Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) ![]() duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains automatically mapped to Pfam PF09150 |
![]() | Family a.175.1.0: automated matches [326230] (1 protein) not a true family |
![]() | Protein automated matches [326231] (3 species) not a true protein |
![]() | Species Nostoc sp. [TaxId:103690] [326232] (1 PDB entry) |
![]() | Domain d5hgra1: 5hgr A:3-175 [326233] Other proteins in same PDB: d5hgra2, d5hgrb2 automated match to d1m98a1 complexed with 45d |
PDB Entry: 5hgr (more details), 1.68 Å
SCOPe Domain Sequences for d5hgra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hgra1 a.175.1.0 (A:3-175) automated matches {Nostoc sp. [TaxId: 103690]} itidsarrifpntlqadavpaltarfnqlsaedqlawtwfaflemgktitvaapgaasmq faegilkqikemtfeeqtqvmcdlanhtdtpicrtyatwspniklgfwnqlgewmeqgav apipagyqlsananavletlksldqgqqitvlrssvvdmgfdaakldgytrva
Timeline for d5hgra1: