Lineage for d5fjrb1 (5fjr B:1-125)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191576Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)
  8. 2191588Domain d5fjrb1: 5fjr B:1-125 [326223]
    Other proteins in same PDB: d5fjra2, d5fjrb2, d5fjrc2, d5fjrd2
    automated match to d1sjda2
    complexed with mg, npq; mutant

Details for d5fjrb1

PDB Entry: 5fjr (more details), 2.44 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: q26a m50i g291d f323y mutant in complex with n-acetyl napthylalanine
PDB Compounds: (B:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjrb1 d.54.1.0 (B:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d5fjrb1:

Click to download the PDB-style file with coordinates for d5fjrb1.
(The format of our PDB-style files is described here.)

Timeline for d5fjrb1: