![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries) |
![]() | Domain d5fjrb1: 5fjr B:1-125 [326223] Other proteins in same PDB: d5fjra2, d5fjrb2, d5fjrc2, d5fjrd2 automated match to d1sjda2 complexed with mg, npq; mutant |
PDB Entry: 5fjr (more details), 2.44 Å
SCOPe Domain Sequences for d5fjrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fjrb1 d.54.1.0 (B:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]} mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa aelgs
Timeline for d5fjrb1: