| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (88 species) not a true protein |
| Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries) |
| Domain d5fjub1: 5fju B:1-125 [326216] Other proteins in same PDB: d5fjua2, d5fjub2, d5fjuc2, d5fjud2 automated match to d1sjda2 complexed with 5cr, mg; mutant |
PDB Entry: 5fju (more details), 2.52 Å
SCOPe Domain Sequences for d5fjub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fjub1 d.54.1.0 (B:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs
Timeline for d5fjub1: