Lineage for d5fjub1 (5fju B:1-125)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191576Species Amycolatopsis sp. [TaxId:37632] [226521] (6 PDB entries)
  8. 2191592Domain d5fjub1: 5fju B:1-125 [326216]
    Other proteins in same PDB: d5fjua2, d5fjub2, d5fjuc2, d5fjud2
    automated match to d1sjda2
    complexed with 5cr, mg; mutant

Details for d5fjub1

PDB Entry: 5fju (more details), 2.52 Å

PDB Description: n-acyl amino acid racemase from amycolatopsis sp. ts-1-60: q26a m50i g291d f323y mutant in complex with n-acetyl phenylalanine
PDB Compounds: (B:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d5fjub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fjub1 d.54.1.0 (B:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtasvrellllravtpagegwgecvtiagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d5fjub1:

Click to download the PDB-style file with coordinates for d5fjub1.
(The format of our PDB-style files is described here.)

Timeline for d5fjub1: