SCOPe 2.08: Domain d1eada_: 1ead A:

Lineage for d1eada_ (1ead A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.1: CAT-like [52778] (3 proteins)
   trimeric enzymes with the active sites being located in between subunits

6. Protein Dihydrolipoamide acetyltransferase [52782] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52783] (9 PDB entries)

8. Domain d1eada_: 1ead A: [32621]
   complexed with cao

Details for d1eada_

PDB Entry: 1ead, 2.6 Å

PDB Description: atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex

PDB Compounds: (A:) dihydrolipoyl-transacetylase

SCOPe Domain Sequences for d1eada_:

Sequence; same for both SEQRES and ATOM records:

>d1eada_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]}
ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
avakkagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna
pevailgvskasmqpvwdgkafqprlmlplslsydhrvingaaaarftkrlgdlladira
ill

Timeline for d1eada_:

• d1eada_ first appeared (with stable ids) in SCOP 1.55, called d1ead__
  
• d1eada_ appears in SCOPe 2.07