![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
![]() | Protein automated matches [190576] (50 species) not a true protein |
![]() | Species Cryptosporidium parvum [TaxId:353152] [326193] (5 PDB entries) |
![]() | Domain d5eloa1: 5elo A:46-193 [326202] Other proteins in same PDB: d5eloa2, d5eloa3, d5elob2, d5elob3, d5eloc2, d5eloc3, d5elod2, d5elod3 automated match to d3bjud1 protein/RNA complex; complexed with edo, krs, lys, so4 |
PDB Entry: 5elo (more details), 1.9 Å
SCOPe Domain Sequences for d5eloa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eloa1 b.40.4.0 (A:46-193) automated matches {Cryptosporidium parvum [TaxId: 353152]} hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr gelslfsksvvllspcyhmlptaisglk
Timeline for d5eloa1: