Lineage for d1eaaa_ (1eaa A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130379Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2130380Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2130381Family c.43.1.1: CAT-like [52778] (3 proteins)
    trimeric enzymes with the active sites being located in between subunits
  6. 2130434Protein Dihydrolipoamide acetyltransferase [52782] (2 species)
  7. 2130435Species Azotobacter vinelandii [TaxId:354] [52783] (9 PDB entries)
  8. 2130440Domain d1eaaa_: 1eaa A: [32620]

Details for d1eaaa_

PDB Entry: 1eaa (more details), 2.6 Å

PDB Description: atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
PDB Compounds: (A:) dihydrolipoyl-transacetylase

SCOPe Domain Sequences for d1eaaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eaaa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]}
ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
avakkagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna
pevailgvskasmqpvwdgkafqprlmlplslsydhrvingaaaarftkrlgdlladira
ill

SCOPe Domain Coordinates for d1eaaa_:

Click to download the PDB-style file with coordinates for d1eaaa_.
(The format of our PDB-style files is described here.)

Timeline for d1eaaa_: