Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (24 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [326196] (5 PDB entries) |
Domain d5elnc2: 5eln C:194-545 [326197] Other proteins in same PDB: d5elna1, d5elna3, d5elnb1, d5elnb3, d5elnc1, d5elnc3, d5elnd1, d5elnd3 automated match to d3bjuc2 protein/RNA complex; complexed with edo, gol, lys |
PDB Entry: 5eln (more details), 1.9 Å
SCOPe Domain Sequences for d5elnc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5elnc2 d.104.1.0 (C:194-545) automated matches {Cryptosporidium parvum [TaxId: 353152]} dqevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaar pfityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefy mayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeie sglgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfii dhpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgd veacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn
Timeline for d5elnc2: