Lineage for d5elnc1 (5eln C:46-189)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790478Species Cryptosporidium parvum [TaxId:353152] [326193] (5 PDB entries)
  8. 2790485Domain d5elnc1: 5eln C:46-189 [326195]
    Other proteins in same PDB: d5elna2, d5elna3, d5elnb2, d5elnb3, d5elnc2, d5elnc3, d5elnd2, d5elnd3
    automated match to d3bjud1
    protein/RNA complex; complexed with edo, gol, lys

Details for d5elnc1

PDB Entry: 5eln (more details), 1.9 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine
PDB Compounds: (C:) Lysine--tRNA ligase

SCOPe Domain Sequences for d5elnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elnc1 b.40.4.0 (C:46-189) automated matches {Cryptosporidium parvum [TaxId: 353152]}
hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts
irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr
gelslfsksvvllspcyhmlptai

SCOPe Domain Coordinates for d5elnc1:

Click to download the PDB-style file with coordinates for d5elnc1.
(The format of our PDB-style files is described here.)

Timeline for d5elnc1: