![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
![]() | Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
![]() | Family c.43.1.1: CAT-like [52778] (3 proteins) trimeric enzymes with the active sites being located in between subunits |
![]() | Protein Dihydrolipoamide acetyltransferase [52782] (2 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [52783] (9 PDB entries) |
![]() | Domain d1dpca_: 1dpc A: [32619] |
PDB Entry: 1dpc (more details), 2.6 Å
SCOPe Domain Sequences for d1dpca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dpca_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk avaekagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna pevailgvskasmqpvwdgkafqprlmlplslsydhrvidgaaaarftkrlgdlladira ill
Timeline for d1dpca_: