| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
| Protein automated matches [190501] (4 species) not a true protein |
| Species Sheep (Ovis aries) [TaxId:9940] [326182] (2 PDB entries) |
| Domain d5d22a_: 5d22 A: [326185] automated match to d4rs1a_ complexed with act, edo |
PDB Entry: 5d22 (more details), 1.99 Å
SCOPe Domain Sequences for d5d22a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d22a_ a.26.1.2 (A:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
qpspvtrpwqhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykq
glrgsltsltgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep
Timeline for d5d22a_: