SCOPe 2.08: Domain d5d22a_: 5d22 A:

Lineage for d5d22a_ (5d22 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [326182] (2 PDB entries)

8. Domain d5d22a_: 5d22 A: [326185]
   automated match to d4rs1a_
   complexed with act, edo

Details for d5d22a_

PDB Entry: 5d22, 1.99 Å

PDB Description: structure of ovine granulocyte-macrophage colony-stimulating factor

PDB Compounds: (A:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d5d22a_:

Sequence; same for both SEQRES and ATOM records:

>d5d22a_ a.26.1.2 (A:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
qpspvtrpwqhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykq
glrgsltsltgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep

Timeline for d5d22a_:

• d5d22a_ first appeared in SCOPe 2.06
  
• d5d22a_ appears in SCOPe 2.07