![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein automated matches [190501] (4 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [326182] (2 PDB entries) |
![]() | Domain d5d28b_: 5d28 B: [326184] automated match to d4rs1a_ complexed with nag, so4 |
PDB Entry: 5d28 (more details), 2.85 Å
SCOPe Domain Sequences for d5d28b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d28b_ a.26.1.2 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]} qhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykqglrgsltsl tgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep
Timeline for d5d28b_: