SCOPe 2.08: Domain d5d28b_: 5d28 B:

Lineage for d5d28b_ (5d28 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [326182] (2 PDB entries)

8. Domain d5d28b_: 5d28 B: [326184]
   automated match to d4rs1a_
   complexed with nag, so4

Details for d5d28b_

PDB Entry: 5d28, 2.85 Å

PDB Description: complex of gm-csf/il-2 inhibition factor with granulocyte-macrophage colony-stimulating factor

PDB Compounds: (B:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d5d28b_:

Sequence; same for both SEQRES and ATOM records:

>d5d28b_ a.26.1.2 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
qhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykqglrgsltsl
tgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep

Timeline for d5d28b_:

• d5d28b_ first appeared in SCOPe 2.06
  
• d5d28b_ appears in SCOPe 2.07