Lineage for d5d22b_ (5d22 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705721Protein automated matches [190501] (4 species)
    not a true protein
  7. 2705779Species Sheep (Ovis aries) [TaxId:9940] [326182] (2 PDB entries)
  8. 2705781Domain d5d22b_: 5d22 B: [326183]
    automated match to d4rs1a_
    complexed with act, edo

Details for d5d22b_

PDB Entry: 5d22 (more details), 1.99 Å

PDB Description: structure of ovine granulocyte-macrophage colony-stimulating factor
PDB Compounds: (B:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d5d22b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d22b_ a.26.1.2 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
qpspvtrpwqhvdaikealsllndstdtaavmdetvevvsemfdsqeptclqtrlelykq
glrgsltsltgsltmmashykkhcpptqetscetqiitfksfkenlkdflfiipfdcwep
v

SCOPe Domain Coordinates for d5d22b_:

Click to download the PDB-style file with coordinates for d5d22b_.
(The format of our PDB-style files is described here.)

Timeline for d5d22b_: