SCOPe 2.06: Domain d1dpba_: 1dpb A:

Lineage for d1dpba_ (1dpb A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.1: CAT-like [52778] (3 proteins)
   trimeric enzymes with the active sites being located in between subunits

6. Protein Dihydrolipoamide acetyltransferase [52782] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52783] (9 PDB entries)

8. Domain d1dpba_: 1dpb A: [32618]

Details for d1dpba_

PDB Entry: 1dpb, 2.5 Å

PDB Description: crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)

PDB Compounds: (A:) dihydrolipoyl-transacetylase

SCOPe Domain Sequences for d1dpba_:

Sequence; same for both SEQRES and ATOM records:

>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]}
ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
avaekagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna
pevailgvskasmqpvwdgkafqprlmlplslsydcrvingaaaarftkrlgdlladira
ill

Timeline for d1dpba_:

• d1dpba_ first appeared (with stable ids) in SCOP 1.55, called d1dpb__
  
• d1dpba_ appears in SCOPe 2.05
  
• d1dpba_ appears in SCOPe 2.07
  
• d1dpba_ appears in the current release, SCOPe 2.08