Lineage for d1dpb__ (1dpb -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) Superfamily c.43.1: CoA-dependent acyltransferases [52777] (1 family) 
Family c.43.1.1: CoA-dependent acyltransferases [52778] (3 proteins) 
Protein Dihydrolipoamide acetyltransferase [52782] (2 species) Species Azotobacter vinelandii [TaxId:354] [52783] (9 PDB entries) 
Domain d1dpb__: 1dpb - [32618]
Details for d1dpb__
PDB Entry: 1dpb (more details), 2.5 Å
PDB Description: crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
SCOP Domain Sequences for d1dpb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dpb__ c.43.1.1 (-) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii}
ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
avaekagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna
pevailgvskasmqpvwdgkafqprlmlplslsydcrvingaaaarftkrlgdlladira
ill
SCOP Domain Coordinates for d1dpb__:
Click to download the PDB-style file with coordinates for d1dpb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dpb__:
- d1dpb__ appears in SCOP 1.57
- d1dpb__ appears in the current release, SCOPe 2.08, called d1dpba_
View in 3D