Class a: All alpha proteins [46456] (289 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) binds to the transactivation domain of human p53 |
Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
Protein MDM2 [47594] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47596] (59 PDB entries) |
Domain d5trfa_: 5trf A: [326171] automated match to d2lzga_ complexed with 7hc, gol, so4 |
PDB Entry: 5trf (more details), 2.1 Å
SCOPe Domain Sequences for d5trfa_:
Sequence, based on SEQRES records: (download)
>d5trfa_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]} tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyde kqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
>d5trfa_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]} tdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlyqh ivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
Timeline for d5trfa_:
View in 3D Domains from other chains: (mouse over for more information) d5trfb_, d5trfc_, d5trfd_, d5trfe_ |