SCOPe 2.04: Domain d1eafa_: 1eaf A:

Lineage for d1eafa_ (1eaf A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.1: CAT-like [52778] (3 proteins)
   trimeric enzymes with the active sites being located in between subunits

6. Protein Dihydrolipoamide acetyltransferase [52782] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52783] (9 PDB entries)

8. Domain d1eafa_: 1eaf A: [32617]
   complexed with so3

Details for d1eafa_

PDB Entry: 1eaf, 2.6 Å

PDB Description: atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex

PDB Compounds: (A:) dihydrolipoyl-transacetylase

SCOPe Domain Sequences for d1eafa_:

Sequence; same for both SEQRES and ATOM records:

>d1eafa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]}
ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
avakkagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna
pevailgvskasmqpvwdgkafqprlmlplslsydhrvingaaaarftkrlgdlladira
ill

Timeline for d1eafa_:

• d1eafa_ first appeared (with stable ids) in SCOP 1.55, called d1eaf__
  
• d1eafa_ appears in SCOPe 2.03
  
• d1eafa_ appears in SCOPe 2.05
  
• d1eafa_ appears in the current release, SCOPe 2.08