SCOPe 2.08: Domain d5lsem_: 5lse M:

Lineage for d5lsem_ (5lse M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
   Uniprot P02953

8. Domain d5lsem_: 5lse M: [326169]
   Other proteins in same PDB: d5lseh1, d5lseh2, d5lsel_
   automated match to d2j8dm_
   complexed with bcl, bph, cdl, d12, fe, lda, po4, spn, u10; mutant

Details for d5lsem_

PDB Entry: 5lse, 2.5 Å

PDB Description: photosynthetic reaction center mutant with glu l212 replaced with ala (chain l, el212w), asp l213 replaced with ala (chain l, dl213a) and leu m215 replaced with ala (chain m, lm215a)

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d5lsem_:

Sequence; same for both SEQRES and ATOM records:

>d5lsem_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsalafamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnhg

Timeline for d5lsem_:

• d5lsem_ first appeared in SCOPe 2.06
  
• d5lsem_ appears in SCOPe 2.07