SCOPe 2.06: Domain d5tt1c_: 5tt1 C:

Lineage for d5tt1c_ (5tt1 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Burkholderia multivorans [TaxId:395019] [226459] (5 PDB entries)

8. Domain d5tt1c_: 5tt1 C: [326167]
   automated match to d3wxbb_
   complexed with edo, no3, so4

Details for d5tt1c_

PDB Entry: 5tt1, 1.8 Å

PDB Description: crystal structure of a putative short-chain alcohol dehydrogenase from burkholderia multivorans

PDB Compounds: (C:) Putative short-chain alcohol dehydrogenase

SCOPe Domain Sequences for d5tt1c_:

Sequence, based on SEQRES records:

>d5tt1c_ c.2.1.0 (C:) automated matches {Burkholderia multivorans [TaxId: 395019]}
dprptillvgasrglghamaaeflkrgwdvvgtvradrgrtplhalaeaypdrlrietld
itqpeqiralaarlsgrvfdilfvnagttnpdptqtigevstddfvdlmitnalspmrvv
etlaglvprdgligimssgqgsiadnesgqrelyrgskaalnqfmrsfaarhaqtplamv
liapgwvrtelggpdarlsidesvpgvvdvllakrgragleyldyrgrtvrw

Sequence, based on observed residues (ATOM records):

>d5tt1c_ c.2.1.0 (C:) automated matches {Burkholderia multivorans [TaxId: 395019]}
dprptillvgasrglghamaaeflkrgwdvvgtvradrgrtplhalaeaypdrlrietld
itqpeqiralaarlsgrvfdilfvnagttnpdptqtigevstddfvdlmitnalspmrvv
etlaglvprdgligimssgqgsiadnesgqrelyrgskaalnqfmrsfaarhaqtplamv
liapgwlsidesvpgvvdvllakrgragleyldyrgrtvrw

Timeline for d5tt1c_:

• d5tt1c_ is new in SCOPe 2.06-stable
  
• d5tt1c_ appears in SCOPe 2.07
  
• d5tt1c_ appears in the current release, SCOPe 2.08