Lineage for d5lttt_ (5ltt T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994438Domain d5lttt_: 5ltt T: [326166]
    Other proteins in same PDB: d5ltta_, d5lttc1, d5lttc2, d5lttd_, d5ltte_, d5lttg_, d5ltti_, d5lttj_, d5lttk_, d5lttl_, d5lttn_, d5ltto_, d5lttq1, d5lttq2, d5lttr_, d5ltts_, d5lttu_, d5lttw_, d5lttx_, d5ltty_, d5lttz_
    automated match to d4g4sg_
    complexed with 39v, cl, mes, mg

Details for d5lttt_

PDB Entry: 5ltt (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; r57t)in complex with pr-924
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5lttt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lttt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5lttt_:

Click to download the PDB-style file with coordinates for d5lttt_.
(The format of our PDB-style files is described here.)

Timeline for d5lttt_: