Lineage for d1qcaa_ (1qca A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115786Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2115787Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2115788Family c.43.1.1: CAT-like [52778] (3 protein domains)
    trimeric enzymes with the active sites being located in between subunits
  6. 2115789Protein Chloramphenicol acetyltransferase, CAT [52779] (2 species)
  7. 2115839Species Shigella flexneri [TaxId:623] [52781] (1 PDB entry)
  8. 2115840Domain d1qcaa_: 1qca A: [32616]
    complexed with co, fua; mutant

Details for d1qcaa_

PDB Entry: 1qca (more details), 2.2 Å

PDB Description: quadruple mutant q92c, n146f, y168f, i172v type iii cat complexed with fusidic acid. crystals grown at ph 6.3. x-ray data collected at room temperature
PDB Compounds: (A:) type III chloramphenicol acetyltransferase

SCOPe Domain Sequences for d1qcaa_:

Sequence, based on SEQRES records: (download)

>d1qcaa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Shigella flexneri [TaxId: 623]}
mnytkfdvknwvrrehfefyrhrlpcgfsltskidittlkkslddsaykfypvmiyliaq
avnqfdelrmaikddelivwdsvdpcftvfhqetetfsalscpyssdidqfmvnylsvme
ryksdtklfpqgvtpenhlfisalpwvnfdsfnlnvanftdffapvitmakyqqegdrll
lplsvqvhhavcdgfhvarfinrlqelcnsklk

Sequence, based on observed residues (ATOM records): (download)

>d1qcaa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Shigella flexneri [TaxId: 623]}
mnytkfdvknwvrrehfefyrhrlpcgfsltskidittlkkslddsaykfypvmiyliaq
avnqfdelrmaikddelivwdsvdpcftvfhqetetfsalscpyssdidqfmvnylsvme
ryksdtklfpqgpenhlfisalpwvnfdsfnlnvanftdffapvitmakyqqegdrlllp
lsvqvhhavcdgfhvarfinrlqelcnsklk

SCOPe Domain Coordinates for d1qcaa_:

Click to download the PDB-style file with coordinates for d1qcaa_.
(The format of our PDB-style files is described here.)

Timeline for d1qcaa_: