SCOPe 2.06: Domain d5tgbb1: 5tgb B:1-108

Lineage for d5tgbb1 (5tgb B:1-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d5tgbb1: 5tgb B:1-108 [326157]
   Other proteins in same PDB: d5tgbb2, d5tgbl2
   automated match to d1dn0a1

Details for d5tgbb1

PDB Entry: 5tgb, 2.74 Å

PDB Description: structure of chimeric 02-cb fab, a vrc01-like germline antibody

PDB Compounds: (B:) 02-CB Fab Light Chain

SCOPe Domain Sequences for d5tgbb1:

Sequence; same for both SEQRES and ATOM records:

>d5tgbb1 b.1.1.1 (B:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqyeffgqgtklei

Timeline for d5tgbb1:

• d5tgbb1 is new in SCOPe 2.06-stable
  
• d5tgbb1 appears in SCOPe 2.07
  
• d5tgbb1 appears in the current release, SCOPe 2.08