Lineage for d5tgbb1 (5tgb B:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743413Domain d5tgbb1: 5tgb B:1-108 [326157]
    Other proteins in same PDB: d5tgbb2, d5tgbl2
    automated match to d1dn0a1

Details for d5tgbb1

PDB Entry: 5tgb (more details), 2.74 Å

PDB Description: structure of chimeric 02-cb fab, a vrc01-like germline antibody
PDB Compounds: (B:) 02-CB Fab Light Chain

SCOPe Domain Sequences for d5tgbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tgbb1 b.1.1.1 (B:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqyeffgqgtklei

SCOPe Domain Coordinates for d5tgbb1:

Click to download the PDB-style file with coordinates for d5tgbb1.
(The format of our PDB-style files is described here.)

Timeline for d5tgbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tgbb2