SCOPe 2.08: Domain d5tfsl2: 5tfs L:109-213

Lineage for d5tfsl2 (5tfs L:109-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5tfsl2: 5tfs L:109-213 [326141]
   Other proteins in same PDB: d5tfsh_, d5tfsl1
   automated match to d1dn0a2
   complexed with so4

Details for d5tfsl2

PDB Entry: 5tfs, 2.32 Å

PDB Description: structure of chimeric 02-k fab, a vrc01-like germline antibody

PDB Compounds: (L:) 02-K Fab Light chain

SCOPe Domain Sequences for d5tfsl2:

Sequence; same for both SEQRES and ATOM records:

>d5tfsl2 b.1.1.2 (L:109-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5tfsl2:

• d5tfsl2 first appeared in SCOPe 2.06
  
• d5tfsl2 appears in SCOPe 2.07