Lineage for d5tt1a_ (5tt1 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454751Species Burkholderia multivorans [TaxId:395019] [226459] (7 PDB entries)
  8. 2454768Domain d5tt1a_: 5tt1 A: [326137]
    automated match to d3wxbb_
    complexed with edo, no3, so4

Details for d5tt1a_

PDB Entry: 5tt1 (more details), 1.8 Å

PDB Description: crystal structure of a putative short-chain alcohol dehydrogenase from burkholderia multivorans
PDB Compounds: (A:) Putative short-chain alcohol dehydrogenase

SCOPe Domain Sequences for d5tt1a_:

Sequence, based on SEQRES records: (download)

>d5tt1a_ c.2.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 395019]}
rptillvgasrglghamaaeflkrgwdvvgtvradrgrtplhalaeaypdrlrietldit
qpeqiralaarlsgrvfdilfvnagttnpdptqtigevstddfvdlmitnalspmrvvet
laglvprdgligimssgqgsiadnesgqrelyrgskaalnqfmrsfaarhaqtplamvli
apgwvrtelggpdarlsidesvpgvvdvllakrgragleyldyrgrtvrw

Sequence, based on observed residues (ATOM records): (download)

>d5tt1a_ c.2.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 395019]}
rptillvgasrglghamaaeflkrgwdvvgtvradrgrtplhalaeaypdrlrietldit
qpeqiralaarlsgrvfdilfvnagttnpdptqtigevstddfvdlmitnalspmrvvet
laglvprdgligimssgqgsiadnesgqrelyrgskaalnqfmrsfaarhaqtplamvli
apgsidesvpgvvdvllakrgragleyldyrgrtvrw

SCOPe Domain Coordinates for d5tt1a_:

Click to download the PDB-style file with coordinates for d5tt1a_.
(The format of our PDB-style files is described here.)

Timeline for d5tt1a_: