Lineage for d5tr7a_ (5tr7 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3015064Species Vibrio cholerae [TaxId:243277] [326101] (1 PDB entry)
  8. 3015065Domain d5tr7a_: 5tr7 A: [326128]
    automated match to d1es4a_
    complexed with gol, no2, peg

Details for d5tr7a_

PDB Entry: 5tr7 (more details), 2.05 Å

PDB Description: crystal structure of a putative d-alanyl-d-alanine carboxypeptidase from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d5tr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tr7a_ e.3.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
dapqiaakgyvlmdyhsgkvlaekemdtklspasltkmmtsyvigqevkrgnislnddvv
isknawaknfpdsskmfvevgttvkvsdlnrgiiiqsgndacvamaehvagtedafvdlm
nawasslgmknshftnshglddpnlystpydlallgqalirdvpeeyaiyseqkftyngi
tqynrngllwdksmnvdgiktghtsgagynlvssategnmrlvavvmgtdnenarkaesk
kllsygfrffe

SCOPe Domain Coordinates for d5tr7a_:

Click to download the PDB-style file with coordinates for d5tr7a_.
(The format of our PDB-style files is described here.)

Timeline for d5tr7a_: