SCOPe 2.08: Domain d5ts2e1: 5ts2 E:1-158

Lineage for d5ts2e1 (5ts2 E:1-158)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein automated matches [190964] (6 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:557722] [326112] (1 PDB entry)

8. Domain d5ts2e1: 5ts2 E:1-158 [326113]
   Other proteins in same PDB: d5ts2a2, d5ts2c2, d5ts2d2, d5ts2e2, d5ts2f2
   automated match to d4rukb_
   complexed with ca, cl, cod

Details for d5ts2e1

PDB Entry: 5ts2, 2.3 Å

PDB Description: crystal structure of a phosphopantetheine adenylyltransferase (coad, ppat) from pseudomonas aeruginosa bound to dephospho coenzyme a

PDB Compounds: (E:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5ts2e1:

Sequence; same for both SEQRES and ATOM records:

>d5ts2e1 c.26.1.3 (E:1-158) automated matches {Pseudomonas aeruginosa [TaxId: 557722]}
mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
ekysfisstlvreiaalggdiskfvhpavadalaerfk

Timeline for d5ts2e1:

• d5ts2e1 first appeared in SCOPe 2.06
  
• d5ts2e1 appears in SCOPe 2.07