Lineage for d1c3rb_ (1c3r B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. Protein HDAC homologue [52774] (1 species)
  7. Species Aquifex aeolicus [TaxId:63363] [52775] (3 PDB entries)
  8. Domain d1c3rb_: 1c3r B: [32608]
    complexed with tsn, zn

Details for d1c3rb_

PDB Entry: 1c3r (more details), 2 Å

PDB Description: crystal structure of an hdac homolog complexed with trichostatin a
PDB Compounds: (B:) hdlp (histone deacetylase-like protein)

SCOPe Domain Sequences for d1c3rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3rb_ c.42.1.2 (B:) HDAC homologue {Aquifex aeolicus [TaxId: 63363]}
kkvkligtldygkyrypknhplkiprvslllrfkdamnlidekeliksrpatkeelllfh
tedyintlmeaersqsvpkgarekyniggyenpvsyamftgsslatgstvqaieeflkgn
vafnpaggmhhafksrangfcyinnpavgieylrkkgfkrilyidldahhcdgvqeafyd
tdqvfvlslhqspeyafpfekgfleeigegkgkgynlniplpkglndneflfalekslei
vkevfepevyllqlgtdplledylskfnlsnvaflkafnivrevfgegvylggggyhpya
larawtliwcelsgrevpeklnnkakellksidfeefddevdrsymletlkdpwrggevr
kevkdtlekaka

SCOPe Domain Coordinates for d1c3rb_ are not available.

Timeline for d1c3rb_:

Domains from other chains:
(mouse over for more information)
d1c3ra_