SCOPe 2.08: Domain d1c3rb_: 1c3r B:

Lineage for d1c3rb_ (1c3r B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
   automatically mapped to Pfam PF00850

6. Protein HDAC homologue [52774] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [52775] (3 PDB entries)

8. Domain d1c3rb_: 1c3r B: [32608]
   complexed with tsn, zn

Details for d1c3rb_

PDB Entry: 1c3r, 2 Å

PDB Description: crystal structure of an hdac homolog complexed with trichostatin a

PDB Compounds: (B:) hdlp (histone deacetylase-like protein)

SCOPe Domain Sequences for d1c3rb_:

Sequence; same for both SEQRES and ATOM records:

>d1c3rb_ c.42.1.2 (B:) HDAC homologue {Aquifex aeolicus [TaxId: 63363]}
kkvkligtldygkyrypknhplkiprvslllrfkdamnlidekeliksrpatkeelllfh
tedyintlmeaersqsvpkgarekyniggyenpvsyamftgsslatgstvqaieeflkgn
vafnpaggmhhafksrangfcyinnpavgieylrkkgfkrilyidldahhcdgvqeafyd
tdqvfvlslhqspeyafpfekgfleeigegkgkgynlniplpkglndneflfalekslei
vkevfepevyllqlgtdplledylskfnlsnvaflkafnivrevfgegvylggggyhpya
larawtliwcelsgrevpeklnnkakellksidfeefddevdrsymletlkdpwrggevr
kevkdtlekaka

Timeline for d1c3rb_:

• d1c3rb_ first appeared (with stable ids) in SCOP 1.55
  
• d1c3rb_ appears in SCOPe 2.07