Lineage for d1c3pa_ (1c3p A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129859Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2129860Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2130138Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2130139Protein HDAC homologue [52774] (1 species)
  7. 2130140Species Aquifex aeolicus [TaxId:63363] [52775] (3 PDB entries)
  8. 2130141Domain d1c3pa_: 1c3p A: [32606]

Details for d1c3pa_

PDB Entry: 1c3p (more details), 1.8 Å

PDB Description: crystal structure of an hdac homolog from aquifex aeolicus
PDB Compounds: (A:) protein (hdlp (histone deacetylase-like protein))

SCOPe Domain Sequences for d1c3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3pa_ c.42.1.2 (A:) HDAC homologue {Aquifex aeolicus [TaxId: 63363]}
kkvkligtldygkyrypknhplkiprvslllrfkdamnlidekeliksrpatkeelllfh
tedyintlmeaercqcvpkgarekyniggyenpvsyamftgsslatgstvqaieeflkgn
vafnpaggmhhafksrangfcyinnpavgieylrkkgfkrilyidldahhcdgvqeafyd
tdqvfvlslhqspeyafpfekgfleeigegkgkgynlniplpkglndneflfalekslei
vkevfepevyllqlgtdplledylskfnlsnvaflkafnivrevfgegvylggggyhpya
larawtliwcelsgrevpeklnnkakellksidfeefddevdrsymletlkdpwrggevr
kevkdtlekaka

SCOPe Domain Coordinates for d1c3pa_:

Click to download the PDB-style file with coordinates for d1c3pa_.
(The format of our PDB-style files is described here.)

Timeline for d1c3pa_: