Lineage for d5m7qb1 (5m7q B:6-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742129Domain d5m7qb1: 5m7q B:6-119 [326051]
    Other proteins in same PDB: d5m7qa2, d5m7qb2
    automated match to d1mqkh_
    complexed with cl, mg, so4

Details for d5m7qb1

PDB Entry: 5m7q (more details), 1.8 Å

PDB Description: engineering the thermostability of nanobodies - nbd2
PDB Compounds: (B:) Nanobody NbD2

SCOPe Domain Sequences for d5m7qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m7qb1 b.1.1.1 (B:6-119) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
esgggsvqaggslrlscavsentgrmgwfrqapgkerekvaiitrlggytsyagpvkgrf
tisqdnakntvyllmnslkpedtaiyycaadsrpiysgtwrywgqgtqvtvssa

SCOPe Domain Coordinates for d5m7qb1:

Click to download the PDB-style file with coordinates for d5m7qb1.
(The format of our PDB-style files is described here.)

Timeline for d5m7qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m7qb2