Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d5lttv_: 5ltt V: [326031] Other proteins in same PDB: d5ltta_, d5lttc1, d5lttc2, d5lttd_, d5ltte_, d5lttg_, d5ltti_, d5lttj_, d5lttk_, d5lttl_, d5lttn_, d5ltto_, d5lttq1, d5lttq2, d5lttr_, d5ltts_, d5lttu_, d5lttw_, d5lttx_, d5ltty_, d5lttz_ automated match to d4r17h_ complexed with 39v, cl, mes, mg |
PDB Entry: 5ltt (more details), 2.7 Å
SCOPe Domain Sequences for d5lttv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lttv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5lttv_:
View in 3D Domains from other chains: (mouse over for more information) d5ltta_, d5lttb_, d5lttc1, d5lttc2, d5lttd_, d5ltte_, d5lttf_, d5lttg_, d5ltth_, d5ltti_, d5lttj_, d5lttk_, d5lttl_, d5lttm_, d5lttn_, d5ltto_, d5lttp_, d5lttq1, d5lttq2, d5lttr_, d5ltts_, d5lttt_, d5lttu_, d5lttw_, d5lttx_, d5ltty_, d5lttz_ |