Lineage for d5lril_ (5lri L:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255327Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2255328Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2255329Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2255521Protein automated matches [190224] (9 species)
    not a true protein
  7. 2255603Species Rhodobacter sphaeroides [TaxId:272943] [326022] (1 PDB entry)
  8. 2255604Domain d5lril_: 5lri L: [326023]
    Other proteins in same PDB: d5lrih1, d5lrih2, d5lrim_
    automated match to d3dsyl_
    complexed with bcl, bph, cdl, dd9, fe, lda, spn, u10; mutant

Details for d5lril_

PDB Entry: 5lri (more details), 2.4 Å

PDB Description: photosynthetic reaction center mutant with glul212 replaced with trp (chain l, el212w)
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d5lril_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lril_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhwdtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d5lril_:

Click to download the PDB-style file with coordinates for d5lril_.
(The format of our PDB-style files is described here.)

Timeline for d5lril_: