![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
![]() | Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) ![]() has two smaller insertion domains |
![]() | Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins) automatically mapped to Pfam PF00314 |
![]() | Protein Thaumatin [49876] (1 species) |
![]() | Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (117 PDB entries) Uniprot P02883 |
![]() | Domain d5lh3a_: 5lh3 A: [326018] automated match to d1kwna_ complexed with tla |
PDB Entry: 5lh3 (more details), 1.64 Å
SCOPe Domain Sequences for d5lh3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lh3a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]} atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda fsyvldkpttvtcpgssnyrvtfcpta
Timeline for d5lh3a_: