![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [326006] (4 PDB entries) |
![]() | Domain d5m12a1: 5m12 A:1-177 [326007] Other proteins in same PDB: d5m12a2, d5m12a3 automated match to d1zy9a1 complexed with 7d0, mg, so4 |
PDB Entry: 5m12 (more details), 1.53 Å
SCOPe Domain Sequences for d5m12a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m12a1 b.30.5.0 (A:1-177) automated matches {Thermotoga maritima [TaxId: 2336]} meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvn nwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsski ahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmenna
Timeline for d5m12a1: