Lineage for d5cevf_ (5cev F:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) 
Family c.42.1.1: Arginase [52769] (1 protein) Protein Arginase [52770] (2 species) 
Species Bacillus caldovelox [TaxId:33931] [52772] (5 PDB entries) 
Domain d5cevf_: 5cev F: [32599]
Details for d5cevf_
PDB Entry: 5cev (more details), 2.5 Å
PDB Description: arginase from bacillus caldevelox, l-lysine complex
SCOP Domain Sequences for d5cevf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cevf_ c.42.1.1 (F:) Arginase {Bacillus caldovelox}
kpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheqg
dsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviwy
dahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldege
kkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgtp
viggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm
SCOP Domain Coordinates for d5cevf_:
Click to download the PDB-style file with coordinates for d5cevf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5cevf_:
- d5cevf_ appears in SCOP 1.57
- d5cevf_ appears in the current release, SCOPe 2.08
View in 3D
