Lineage for d5ceve_ (5cev E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129859Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2129860Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2129861Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2129882Protein Arginase [52770] (5 species)
  7. 2129883Species Bacillus caldovelox [TaxId:33931] [52772] (5 PDB entries)
  8. 2129906Domain d5ceve_: 5cev E: [32598]
    complexed with gai, lys, mn

Details for d5ceve_

PDB Entry: 5cev (more details), 2.5 Å

PDB Description: arginase from bacillus caldevelox, l-lysine complex
PDB Compounds: (E:) protein (arginase)

SCOPe Domain Sequences for d5ceve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ceve_ c.42.1.1 (E:) Arginase {Bacillus caldovelox [TaxId: 33931]}
kpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheqg
dsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviwy
dahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldege
kkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgtp
viggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm

SCOPe Domain Coordinates for d5ceve_:

Click to download the PDB-style file with coordinates for d5ceve_.
(The format of our PDB-style files is described here.)

Timeline for d5ceve_: