Lineage for d5l61b_ (5l61 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994621Domain d5l61b_: 5l61 B: [325964]
    Other proteins in same PDB: d5l61a_, d5l61c1, d5l61c2, d5l61d_, d5l61e_, d5l61g_, d5l61i_, d5l61j_, d5l61k_, d5l61l_, d5l61n_, d5l61o_, d5l61q1, d5l61q2, d5l61r_, d5l61s_, d5l61u_, d5l61w_, d5l61x_, d5l61y_, d5l61z_
    automated match to d1z7qc1
    complexed with 6n5, cl, mes, mg

Details for d5l61b_

PDB Entry: 5l61 (more details), 2.8 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (99- 132) in complex with epoxyketone inhibitor 14
PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5l61b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l61b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d5l61b_:

Click to download the PDB-style file with coordinates for d5l61b_.
(The format of our PDB-style files is described here.)

Timeline for d5l61b_: