Lineage for d5lsel_ (5lse L:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632597Protein L (light) subunit [81477] (3 species)
  7. 2632598Species Rhodobacter sphaeroides [TaxId:1063] [81475] (65 PDB entries)
    Uniprot P02954
  8. 2632658Domain d5lsel_: 5lse L: [325957]
    Other proteins in same PDB: d5lseh1, d5lseh2, d5lsem_
    automated match to d1k6nl_
    complexed with bcl, bph, cdl, d12, fe, lda, po4, spn, u10; mutant

Details for d5lsel_

PDB Entry: 5lse (more details), 2.5 Å

PDB Description: photosynthetic reaction center mutant with glu l212 replaced with ala (chain l, el212w), asp l213 replaced with ala (chain l, dl213a) and leu m215 replaced with ala (chain m, lm215a)
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d5lsel_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lsel_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhaatffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d5lsel_:

Click to download the PDB-style file with coordinates for d5lsel_.
(The format of our PDB-style files is described here.)

Timeline for d5lsel_: