Lineage for d5ceva_ (5cev A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23890Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
  4. 23891Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 23892Family c.42.1.1: Arginase [52769] (1 protein)
  6. 23893Protein Arginase [52770] (2 species)
  7. 23894Species Bacillus caldovelox [TaxId:33931] [52772] (5 PDB entries)
  8. 23913Domain d5ceva_: 5cev A: [32594]

Details for d5ceva_

PDB Entry: 5cev (more details), 2.5 Å

PDB Description: arginase from bacillus caldevelox, l-lysine complex

SCOP Domain Sequences for d5ceva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ceva_ c.42.1.1 (A:) Arginase {Bacillus caldovelox}
kpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheqg
dsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviwy
dahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldege
kkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgtp
viggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm

SCOP Domain Coordinates for d5ceva_:

Click to download the PDB-style file with coordinates for d5ceva_.
(The format of our PDB-style files is described here.)

Timeline for d5ceva_: