Lineage for d1ceve_ (1cev E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2873863Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2873884Protein Arginase [52770] (5 species)
  7. 2873885Species Bacillus caldovelox [TaxId:33931] [52772] (5 PDB entries)
  8. 2873902Domain d1ceve_: 1cev E: [32592]
    complexed with mn

Details for d1ceve_

PDB Entry: 1cev (more details), 2.4 Å

PDB Description: arginase from bacillus caldovelox, native structure at ph 5.6
PDB Compounds: (E:) protein (arginase)

SCOPe Domain Sequences for d1ceve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ceve_ c.42.1.1 (E:) Arginase {Bacillus caldovelox [TaxId: 33931]}
mkpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheq
gdsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviw
ydahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldeg
ekkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgt
pviggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm

SCOPe Domain Coordinates for d1ceve_:

Click to download the PDB-style file with coordinates for d1ceve_.
(The format of our PDB-style files is described here.)

Timeline for d1ceve_: