Lineage for d1cevc_ (1cev C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23890Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
  4. 23891Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 23892Family c.42.1.1: Arginase [52769] (1 protein)
  6. 23893Protein Arginase [52770] (2 species)
  7. 23894Species Bacillus caldovelox [TaxId:33931] [52772] (5 PDB entries)
  8. 23909Domain d1cevc_: 1cev C: [32590]

Details for d1cevc_

PDB Entry: 1cev (more details), 2.4 Å

PDB Description: arginase from bacillus caldovelox, native structure at ph 5.6
PDB Compounds: (C:)

SCOP Domain Sequences for d1cevc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cevc_ c.42.1.1 (C:) Arginase {Bacillus caldovelox}
mkpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheq
gdsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviw
ydahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldeg
ekkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgt
pviggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm

SCOP Domain Coordinates for d1cevc_:

Click to download the PDB-style file with coordinates for d1cevc_.
(The format of our PDB-style files is described here.)

Timeline for d1cevc_: